PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00523.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 705aa    MW: 76913.6 Da    PI: 6.9202
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00523.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.51.2e-07286327338
                      zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 
                                   +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  Zmw_sc00523.1.g00090.1.am.mk 286 ARACDGCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 327
                                   578*****************************6567777776 PP

2CCT63.28e-22650693144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+++RY+eKr tR+F+KkirYe+ K +Ae+RpR+KGrFvk+a
  Zmw_sc00523.1.g00090.1.am.mk 650 REARVSRYREKRLTRLFSKKIRYEVCKLNAEKRPRMKGRFVKRA 693
                                   9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.48284331IPR000315B-box-type zinc finger
SMARTSM003363.2E-11284331IPR000315B-box-type zinc finger
PfamPF006432.4E-6287328IPR000315B-box-type zinc finger
CDDcd000215.90E-8287331No hitNo description
PfamPF062035.2E-16650692IPR010402CCT domain
PROSITE profilePS5101714.703650692IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MGGSCPGERK YQRSVTKDTG SIVEGLFCKM QFSFWEPRTA PQSKTVDQVH VLWTAACRQT  60
SRGEPIDSKQ QGWEHADHAP FSLVLDHAGS SPRPRVPVYC DGIVASNYAC APIDGDPGSV  120
TRAVVLLHKR HDCLRAHARQ LPAPSHHQFA QFHHASGDSA TMQGDLPHPL ITAAAIMSFI  180
VDKTTTTMDG REPQWRNERK FLVLPGRTKA AHSNRDRGRE RRRKGSGCRL AQWSGPPEIP  240
SQPMAGALAG WSVHETSPAS KIVAPRRQEM ITTSSSAMAA VGSKAARACD GCLRRRARWY  300
CAADDAFLCQ GCDTSVHSAN PLARRHERLR LQQSSLPMQS PPAAGGAAKQ CERRDEVVPA  360
WFRRKARTPR GGQAVAKRLI VPEAAGGGNS SEGRSCVGEV EAEEQLLYRV PVFDPALAEF  420
CLPPPLEDTA AAASSCCNAD GDVVNSTKPD AAPPPQPPPT TQFFPHRCAG FEPTDAELRE  480
FAADMEALLG RGLDDGNEED PFYMETLGLL DPVVDDGARV KVENEVGGAY EAIDELACRL  540
DVEPEASDEM LDIDFDYGSP QETPEEKAAS SDGTGSDAMF LQRSLCLTLN YEAIIESWES  600
SPWTGGGCRP HVKLDDCWLH DYSGMWVMGG VVGHGGEEMS LPRLGMDGGR EARVSRYREK  660
RLTRLFSKKI RYEVCKLNAE KRPRMKGRFV KRATAGGSVT IAGLA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965182.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
TrEMBLA0A0A9S1W60.0A0A0A9S1W6_ARUDO; Uncharacterized protein
STRINGSi006432m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058